SBC logo Authors: Bob MacCallum, Andrea Krings, Markus Brameier and Amine Heddad, Stockholm Bioinformatics Center, Stockholm University, Sweden.

NucPred - multiple sequences

NucPred looks at sequence patterns and sequence composition and predicts if a protein spends at least part of its time in the nucleus. It also gives a colour-coded estimation of the per-residue contribution to the protein's nuclear localisation. In multiple sequence mode, each sequence is analysed separately and then displayed together in a ClustalW multiple sequence alignment.

Example query: Probable RNA-binding protein 25 (with orthologues)

Enter up to 15 related sequences in the box below using "FASTA format" (fictional format example below): 
>P12345 optional description here
GDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFT
NPPQVATYHRAIKITVDGPREPRNARQIQPSPPWSYDQSYQYLGSIT
>P98765 optional description here
RASGMTSLSAELSSRLSTAPDLTAFGDPRQFPTLPSISDPRMHYPGAFTYSPPVTSGIGI
GMSAMSSASRYHTYLPPPYPGSSQ


 
Go back to the NucPred Home Page.